PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr5P10510_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family HD-ZIP
Protein Properties Length: 795aa    MW: 86240.4 Da    PI: 7.1786
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr5P10510_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox665.1e-21116171156
                            TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
               Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                            +++ +++t++q++eLe+lF+++++p++++r eL+k+l+L+ rqVk+WFqNrR+++k
  GSMUA_Achr5P10510_001 116 KKRYHRHTPQQIQELEALFKECPHPDEKQRLELSKRLSLEARQVKFWFQNRRTQMK 171
                            688999***********************************************999 PP

2START157.21.3e-492955441205
                            HHHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S.. CS
                  START   1 elaeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla.. 77 
                            ela++a++el+k+a+ +ep+W   +    e +n+de+ ++++   +     + +ea ra+g+v+ ++  lve+l+d + +W  +++  
  GSMUA_Achr5P10510_001 295 ELALTAMDELLKMAQMGEPLWIPGVdgskETLNYDEYDRSVPCCIGakpigFVSEATRATGAVIINSLALVETLMDAN-RWADMFPsi 381
                            5899******************99988788888888888887766699999***************************.********* PP

                            ..EEEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEE CS
                  START  78 ..kaetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliep 156
                              + +t+ vis g      g lqlm+aelq+lsplvp R + f+R+++ql + +w+ vdvS+d  ++ + s++   +++lpSg+++++
  GSMUA_Achr5P10510_001 382 vaRSTTTGVISGGmggsknGSLQLMQAELQVLSPLVPvRHVQFLRFCKQLADAVWAMVDVSIDGIRDST-SAQQTNCRRLPSGCVVQD 468
                            *9******************************************************************9.9***************** PP

                            ECTCE...........................EEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXX CS
                  START 157 ksngh...........................skvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqce 205
                            ++ng+                            +vtwveh++++++++h l+r+l++sg+a ga +wva+lqrqc 
  GSMUA_Achr5P10510_001 469 LPNGYskltmwltllshhystrrvafstrrcgAQVTWVEHAEYDEATVHPLYRPLLRSGMALGAHRWVAALQRQCH 544
                            ******************************999*****************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.7E-21100174IPR009057Homeodomain-like
SuperFamilySSF466892.31E-20104173IPR009057Homeodomain-like
PROSITE profilePS5007117.864113173IPR001356Homeobox domain
SMARTSM003894.7E-19114177IPR001356Homeobox domain
CDDcd000861.07E-18116173No hitNo description
PfamPF000461.4E-18116171IPR001356Homeobox domain
PROSITE patternPS000270148171IPR017970Homeobox, conserved site
PROSITE profilePS5084837.59286548IPR002913START domain
SuperFamilySSF559617.6E-24289472No hitNo description
CDDcd088755.07E-109292543No hitNo description
PfamPF018521.6E-42295544IPR002913START domain
SMARTSM002347.7E-33295545IPR002913START domain
SuperFamilySSF559617.6E-24500544No hitNo description
SuperFamilySSF559611.98E-20564764No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 795 aa     Download sequence    Send to blast
MSFRGLFDGG SGGGDRVVAD APYRSSIAMS AGSISQPFLT SPSLPNPVFS SPGLSLALQT  60
NMEGQGDAAV AGKGGRGEPD SLRRSKEDEN ESRSGGSDNL EVISGDDFEQ ENPRKKKRYH  120
RHTPQQIQEL EALFKECPHP DEKQRLELSK RLSLEARQVK FWFQNRRTQM KTQIERHENT  180
ILRQENDKLH AENLSIREAM RNPICSSCCG PAVLGDVSLE EQHLRIENAR LKDELDRVCS  240
LIGKFLGKPI SVLSGPVPVS ISNSSLELAV GTNAFGGLGS VVTTTLPPER FVLLELALTA  300
MDELLKMAQM GEPLWIPGVD GSKETLNYDE YDRSVPCCIG AKPIGFVSEA TRATGAVIIN  360
SLALVETLMD ANRWADMFPS IVARSTTTGV ISGGMGGSKN GSLQLMQAEL QVLSPLVPVR  420
HVQFLRFCKQ LADAVWAMVD VSIDGIRDST SAQQTNCRRL PSGCVVQDLP NGYSKLTMWL  480
TLLSHHYSTR RVAFSTRRCG AQVTWVEHAE YDEATVHPLY RPLLRSGMAL GAHRWVAALQ  540
RQCHSLAVLV SSSLPPGDNT TITPSGRRSM LKLAQRMTDN FCAGVCASSA HQWNKLRGGV  600
DIGEDVRVMT RQSVANPGEP PGVVLSAATS VWLPVAPQRL FDFLRNERLR SQWDILSNGG  660
PMQEMAHIAK GQDTTGNAVT LLRASAVSAD QSSMLILQET CTDASGSLVV YAPVDVPAMH  720
LVMSGGDSSY VALLPSGFAI LPDGRKAVGS LLTVAFQILV NSQPTAKLTV ESVETVNNLI  780
SCTVQKIKAA LRCEA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009400446.10.0PREDICTED: homeobox-leucine zipper protein ROC5-like
SwissprotQ0WV120.0ANL2_ARATH; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
TrEMBLM0SXD00.0M0SXD0_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr5P10510_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP120337116
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein